PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT15265
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family WRKY
Protein Properties Length: 386aa    MW: 42716 Da    PI: 8.2805
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT15265genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY99.52.2e-3187143259
               --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
               dDgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkve+++ d+++ ei+Y+g+Hnh+
  EMT15265  87 DDGYNWRKYGQKVVKGSDCPRSYYKCTHPSCPVKKKVEHAE-DGHISEIIYKGKHNHQ 143
               8**************************************99.***************8 PP

2WRKY41.82.1e-13243267125
               ---SS-EEEEEEE--TT-SS-EEEE CS
      WRKY   1 ldDgynWrKYGqKevkgsefprsYY 25 
               ldDgy+WrKYGqK+vkg+++pr+Y+
  EMT15265 243 LDDGYRWRKYGQKVVKGNPHPRKYF 267
               59**********************8 PP

3WRKY55.21.4e-172953322259
               EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
      WRKY  22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                sYY+Ct+agC+v+k++er+++dpk+v++tYeg+Hnhe
  EMT15265 295 WSYYKCTFAGCNVRKHIERASSDPKAVITTYEGKHNHE 332
               59***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.1E-2883145IPR003657WRKY domain
SuperFamilySSF1182906.02E-2585145IPR003657WRKY domain
SMARTSM007743.4E-3386144IPR003657WRKY domain
PROSITE profilePS5081122.99787145IPR003657WRKY domain
PfamPF031066.0E-2487143IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-31229263IPR003657WRKY domain
SuperFamilySSF1182901.29E-11235267IPR003657WRKY domain
PROSITE profilePS5081132.133238334IPR003657WRKY domain
SMARTSM007742.5E-34243333IPR003657WRKY domain
PfamPF031069.3E-10244269IPR003657WRKY domain
PfamPF031062.0E-11293332IPR003657WRKY domain
SuperFamilySSF1182909.68E-13294334IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-31295334IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MSHQQALAQV TAQASHSPHR MFDHTEQPSF SAAATSSGAL QNMSSAANVA EMSEMATTIS  60
NNEHAAFQSA EASHRYQVPA PVDKPADDGY NWRKYGQKVV KGSDCPRSYY KCTHPSCPVK  120
KKVEHAEDGH ISEIIYKGKH NHQRPPNKRA KDGSSSAAEQ NEQSNDTASG LSGVRRDQEA  180
VYGMSEQLSG LSDGDDKDDG ESRPNEVDDR ENDCKRRNIQ ISSQKALTES KIIVQTTSEV  240
DLLDDGYRWR KYGQKVVKGN PHPRKYFPVY ALPVDLIGPF GHRLAPYSVY MQCMWSYYKC  300
TFAGCNVRKH IERASSDPKA VITTYEGKHN HEPPVGRGSN QNGGNSNRSQ QKGPNSMSSN  360
QASHTGTDLG NIKQGQIGVL QFKREE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-3387334877Probable WRKY transcription factor 4
2lex_A4e-3387334877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX2168400.0JX216840.1 Hordeum vulgare WRKY61 protein (WRKY61) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576063.10.0PREDICTED: probable WRKY transcription factor 3
TrEMBLN1R0810.0N1R081_AEGTA; Putative WRKY transcription factor 3
STRINGMLOC_69575.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP134538122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.15e-92WRKY DNA-binding protein 3